PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA44G00503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 286aa    MW: 32569.3 Da    PI: 6.0387
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA44G00503genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.1e-141865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l ++    G g+W+ +a+  g+ R++k+c++rw +yl
       AA44G00503 18 KGLWSPEEDAKLMQYMMSNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 65
                     678*******************************************97 PP

2Myb_DNA-binding482.8e-1571114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++ E++l+++ +  lG++ W+ Ia++++ gRt++++k++w++
       AA44G00503  71 RGAFSPHEEDLIIRFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 114
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-231268IPR009057Homeodomain-like
PROSITE profilePS5129416.141365IPR017930Myb domain
SuperFamilySSF466894.3E-2816112IPR009057Homeodomain-like
SMARTSM007173.0E-111767IPR001005SANT/Myb domain
PfamPF002495.9E-141865IPR001005SANT/Myb domain
CDDcd001675.23E-92165No hitNo description
PROSITE profilePS5129423.57866120IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-2569121IPR009057Homeodomain-like
SMARTSM007175.3E-1570118IPR001005SANT/Myb domain
PfamPF002491.2E-1371114IPR001005SANT/Myb domain
CDDcd001673.28E-1073113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MRKPEVMING QQSKKMKKGL WSPEEDAKLM QYMMSNGQGC WSDVAKNAGL QRCGKSCRLR  60
WINYLRPDLK RGAFSPHEED LIIRFHSILG NRWSQIAARL PGRTDNEIKN FWNSTIKKRL  120
KNMSTTSNLI NTSSRSSPNT SDSSSSSSLD LKDIIGSFMS LQEHGLITTN PSLNHIPTNN  180
TSFPNNHLSN NDDFALFGDG FYGVNTVLQG EEVSCFPSLQ GVNVECEETD NWYINNQLED  240
MNTINNGVGI NGQESNLRLE EYYWDIDQLM NNEVNPSFYF NFKPNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27181207108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013674543.11e-121PREDICTED: transcription factor MYB46-like
RefseqXP_013626410.11e-121PREDICTED: transcription factor MYB46-like
RefseqXP_006288326.11e-121hypothetical protein CARUB_v10001573mg, partial
SwissprotQ9LXV21e-120MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A087G6M21e-127A0A087G6M2_ARAAL; Uncharacterized protein
STRINGBra006166.1-P1e-119(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-120myb domain protein 46